JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
TAS2R30

TAS2R30

Description	Taste receptor type 2 member 30

Gene and Protein Information

Gene ID	259293
Uniprot Accession IDs	Q645X7 T2R30
Ensembl ID	ENSP00000444736
Symbol	TAS2R47 T2R30 T2R47 TAS2R47
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100609864	LOC100609864	taste receptor type 2 member 30-like	9598		OMA, EggNOG
Dog	100271744	CAFA-T2R43	bitter taste receptor Cafa-T2R43	9615		OMA, EggNOG
Horse	100065752	LOC100065752	taste receptor type 2 member 46-like	9796		OMA, EggNOG
Cow	664639	TAS2R46	taste receptor, type 2, member 46	9913		OMA, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 30

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source