Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Taste receptor type 2 member 30

Gene ID259293
uniprotP59541
Gene NameTAS2R30
Ensernbl IDENSP00000444736
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN259293TAS2R30Taste receptor type 2 member 30P59541

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 30

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source