The store will not work correctly when cookies are disabled.
TAS2R30
| Description | Taste receptor type 2 member 30 |
|---|
Gene and Protein Information
| Gene ID | 259293 |
|---|
| Uniprot Accession IDs | Q645X7 T2R30 |
|---|
| Ensembl ID | ENSP00000444736 |
|---|
| Symbol | TAS2R47 T2R30 T2R47 TAS2R47 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100609864 | LOC100609864 | taste receptor type 2 member 30-like | 9598 | | OMA, EggNOG |
| Dog | 100271744 | CAFA-T2R43 | bitter taste receptor Cafa-T2R43 | 9615 | | OMA, EggNOG |
| Horse | 100065752 | LOC100065752 | taste receptor type 2 member 46-like | 9796 | | OMA, EggNOG |
| Cow | 664639 | TAS2R46 | taste receptor, type 2, member 46 | 9913 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
