JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
TAS2R60

TAS2R60

Description	Taste receptor type 2 member 60

Gene and Protein Information

Gene ID	338398
Uniprot Accession IDs	A4D2G8 Q645W8 Q7RTR7 T2R60
Ensembl ID	ENSP00000327724
Symbol	T2R56 T2R60
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSNCRLRAVLKSRRSSRCGTP Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	493890	TAS2R60	taste 2 receptor member 60	9598	VGNC:8777	Inparanoid, OMA, EggNOG
Mouse	387512	Tas2r135	taste receptor, type 2, member 135	10090	MGI:2681302	Inparanoid, OMA, EggNOG
Rat	502757	Tas2r135	taste receptor, type 2, member 135	10116	RGD:1561078	Inparanoid, OMA, EggNOG
Pig	100524179	TAS2R60	taste 2 receptor member 60	9823		OMA, EggNOG
Opossum	664662	TAS2R60	taste 2 receptor member 60	13616		OMA, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 60

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]