EIF3F
| Description | Eukaryotic translation initiation factor 3 subunit F |
|---|
Gene and Protein Information
| Gene ID | 8665 |
|---|---|
| Uniprot Accession IDs | A8K0S2 Q6IB45 Q8N978 eIF3f |
| Ensembl ID | ENSP00000431800 |
| Symbol | EIF3S5 MRT67 EIF3S5 eIF3-p47 |
| Family | Belongs to the eIF-3 subunit F family. |
| Sequence | MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451007 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 9598 | VGNC:6485 | Inparanoid, OMA, EggNOG |
| Macaque | 706269 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66085 | Eif3f | eukaryotic translation initiation factor 3, subunit F | 10090 | MGI:1913335 | Inparanoid, OMA, EggNOG |
| Rat | 293427 | Eif3f | eukaryotic translation initiation factor 3, subunit F | 10116 | RGD:1306112 | Inparanoid, OMA |
| Dog | 476840 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 9615 | VGNC:40272 | Inparanoid, OMA, EggNOG |
| Horse | 100071582 | LOC100071582 | eukaryotic translation initiation factor 3 subunit F | 9796 | OMA, EggNOG | |
| Cow | 513793 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 9913 | VGNC:28396 | Inparanoid, OMA, EggNOG |
| Opossum | 100030376 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 423748 | EIF3F | eukaryotic translation initiation factor 3 subunit F | 9031 | CGNC:3965 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567597 | eif3f | eukaryotic translation initiation factor 3 subunit F | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548944 | eif3f | eukaryotic translation initiation factor 3 subunit F | 8364 | XB-GENE-5898648 | Inparanoid, OMA, EggNOG |
| C. elegans | 174478 | eif-3.F | Eukaryotic translation initiation factor 3 subunit F | 6239 | Inparanoid, OMA | |
| Fruitfly | 40587 | CG9769 | CG9769 gene product from transcript CG9769-RA | 7227 | FBgn0037270 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / metalloprotease / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / metalloprotease / Eukaryotic translation initiation factor 3 subunit F
DTO Classes
protein / Enzyme / Protease / Metalloprotease / Eukaryotic translation initiation factor 3 subunit F
protein / Enzyme / Protease / Metalloprotease / Eukaryotic translation initiation factor 3 subunit F
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|