Protein or Target Summary
Eukaryotic translation initiation factor 3 subunit F
| Gene ID | 8665 |
|---|---|
| uniprot | O00303 |
| Gene Name | EIF3F |
| Ensernbl ID | ENSP00000431800 |
| Family | Belongs to the eIF-3 subunit F family. |
| Sequence | MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 8665 | EIF3F | Eukaryotic translation initiation factor 3 subunit F | O00303 |
| MOUSE | 66085 | Eif3f | Eukaryotic translation initiation factor 3 subunit F | Q9DCH4 |
| MOUSE | Eif3f | Eukaryotic translation initiation factor 3 subunit 5 epsilon | B0LAD0 | |
| MOUSE | 66085 | Eif3f | Eukaryotic translation initiation factor 3 subunit F | Q3U8X1 |
| MOUSE | Eif3f | Eukaryotic translation initiation factor 3 subunit F | Q8BTW2 | |
| MOUSE | 66085 | Eif3f | Eukaryotic translation initiation factor 3 subunit F | Q3UVY8 |
| MOUSE | Eif3f | Translation initiation factor-3 subunit 5 | Q8VH52 | |
| MOUSE | Eif3f | Eukaryotic translation initiation factor 3 subunit F | Q6IRT4 | |
| RAT | 293427 | Eif3f | Eukaryotic translation initiation factor 3 subunit F | D4AC36 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / metalloprotease / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit F
protein / nucleic acid binding / metalloprotease / Eukaryotic translation initiation factor 3 subunit F
DTO Classes
protein / Enzyme / Protease / Metalloprotease / Eukaryotic translation initiation factor 3 subunit F
protein / Enzyme / Protease / Metalloprotease / Eukaryotic translation initiation factor 3 subunit F
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx