The store will not work correctly when cookies are disabled.
TAS2R5
| Description | Taste receptor type 2 member 5 |
|---|
Gene and Protein Information
| Gene ID | 54429 |
|---|
| Uniprot Accession IDs | Q645W0 Q75MV7 T2R5 |
|---|
| Ensembl ID | ENSP00000247883 |
|---|
| Symbol | T2R5 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQWLIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPFSITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 463786 | TAS2R5 | taste 2 receptor member 5 | 9598 | VGNC:8776 | Inparanoid, OMA, EggNOG |
| Dog | 100271743 | TAS2R5 | taste 2 receptor member 5 | 9615 | VGNC:47120 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
