The store will not work correctly when cookies are disabled.
UPP1
| Description | Uridine phosphorylase 1 |
|---|
Gene and Protein Information
| Gene ID | 7378 |
|---|
| Uniprot Accession IDs | D3DVM4 Q15362 UPase 1 |
|---|
| Ensembl ID | ENSP00000330032 |
|---|
| Symbol | UP UP UPP UPASE UDRPASE |
|---|
| Family | Belongs to the PNP/UDP phosphorylase family. |
|---|
| Sequence | MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472361 | UPP1 | uridine phosphorylase 1 | 9598 | VGNC:4558 | OMA, EggNOG |
| Macaque | 695317 | UPP1 | uridine phosphorylase 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 22271 | Upp1 | uridine phosphorylase 1 | 10090 | MGI:1097668 | Inparanoid, OMA, EggNOG |
| Rat | 289801 | Upp1 | uridine phosphorylase 1 | 10116 | RGD:1305566 | Inparanoid, OMA |
| Dog | 100856638 | LOC100856638 | uridine phosphorylase 1-like | 9615 | | OMA, EggNOG |
| Horse | 100052199 | UPP1 | uridine phosphorylase 1 | 9796 | VGNC:24812 | Inparanoid, OMA, EggNOG |
| Cow | 515029 | UPP1 | uridine phosphorylase 1 | 9913 | VGNC:36688 | Inparanoid, OMA, EggNOG |
| Pig | 100625277 | UPP1 | uridine phosphorylase 1 | 9823 | | OMA, EggNOG |
| Opossum | 100030227 | UPP1 | uridine phosphorylase 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100075402 | UPP1 | uridine phosphorylase 1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 420942 | UPP1 | uridine phosphorylase 1 | 9031 | CGNC:9886 | Inparanoid, OMA |
| Anole lizard | 100562309 | upp2 | uridine phosphorylase 2 | 28377 | | Inparanoid, EggNOG |
| Xenopus | | upp1 | uridine phosphorylase 1 [Source:Xenbase;Acc:XB-GENE-1000352] | 8364 | | OMA, EggNOG |
| Zebrafish | 503707 | upp1 | uridine phosphorylase 1 | 7955 | ZDB-GENE-050306-2 | Inparanoid, OMA |
| C. elegans | 176077 | upp-1 | Uridine and thymidine phosphorylase | 6239 | | Inparanoid, OMA |
| Fruitfly | 37644 | CG3788 | CG3788 gene product from transcript CG3788-RB | 7227 | FBgn0034800 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
