JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tryptophan 2,3-dioxygenase

Gene ID	6999
uniprot	P48775
Gene Name	TDO2
Ensernbl ID	ENSP00000444788
Family	Belongs to the tryptophan 2,3-dioxygenase family.
Sequence	MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	6999	TDO2	Tryptophan 2,3-dioxygenase	P48775
MOUSE		Tdo2	Tryptophan 2,3-dioxygenase	C5NSA7
MOUSE	56720	Tdo2	Tryptophan 2,3-dioxygenase	Q8VCW3
MOUSE	56720	Tdo2	Tryptophan 2,3-dioxygenase	P48776
RAT	64206	Tdo2	Tryptophan 2,3-dioxygenase	P21643

Protein Classes

PANTHER Classes
protein / oxidoreductase / oxygenase / Tryptophan 2,3-dioxygenase

DTO Classes
protein / Enzyme / Oxidoreductase / Oxygenase / Tryptophan 2,3-dioxygenase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx