The store will not work correctly when cookies are disabled.
Protein or Target Summary
UDP-glucuronosyltransferase 2B17
| Gene ID | 7367 |
|---|
| uniprot | O75795 |
|---|
| Gene Name | UGT2B17 |
|---|
| Ensernbl ID | ENSP00000320401 |
|---|
| Family | Belongs to the UDP-glycosyltransferase family. |
|---|
| Sequence | MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7367 | UGT2B17 | UDP-glucuronosyltransferase 2B17 | O75795 |
| MOUSE | | Ugt2b17 | UDP-glucuronosyltransferase 2B17 | P17717 |
| RAT | | Ugt2b17 | UDP-glucuronosyltransferase 2B17 | A0A0G2JUD3 |
| RAT | 266685 | Ugt2b17 | UDP-glucuronosyltransferase 2B17 | P08542 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
