The store will not work correctly when cookies are disabled.
XPNPEP2
| Description | Xaa-Pro aminopeptidase 2 |
|---|
Gene and Protein Information
| Gene ID | 7512 |
|---|
| Uniprot Accession IDs | A0AV16 O75994 |
|---|
| Ensembl ID | ENSP00000360147 |
|---|
| Symbol | APP2 AEACEI |
|---|
| Family | Belongs to the peptidase M24B family. |
|---|
| Sequence | MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 465852 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9598 | VGNC:14724 | OMA, EggNOG |
| Macaque | 701972 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 170745 | Xpnpep2 | X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | 10090 | MGI:2180001 | Inparanoid, OMA, EggNOG |
| Rat | 117522 | Xpnpep2 | X-prolyl aminopeptidase 2 | 10116 | RGD:621277 | Inparanoid, OMA, EggNOG |
| Dog | 492124 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9615 | VGNC:48458 | Inparanoid, OMA, EggNOG |
| Horse | 100059029 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9796 | VGNC:25073 | Inparanoid, OMA, EggNOG |
| Cow | 504822 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9913 | VGNC:36995 | Inparanoid, OMA, EggNOG |
| Pig | 445538 | XPNPEP2 | X-prolyl aminopeptidase 2 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100021640 | XPNPEP2 | X-prolyl aminopeptidase 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563559 | xpnpep2 | X-prolyl aminopeptidase 2 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100145559 | xpnpep2 | X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | 8364 | XB-GENE-969249 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394007 | xpnpep2 | X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | 7955 | ZDB-GENE-040426-1151 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 850630 | FRA1 | Fra1p | 4932 | S000003952 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
