Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

TIMP2

DescriptionMetalloproteinase inhibitor 2

Gene and Protein Information

Gene ID7077
Uniprot Accession IDs Q16121 Q93006 Q9UDF7
Ensembl ID ENSP00000262768
Symbol DDC8 CSC-21K
FamilyBelongs to the protease inhibitor I35 (TIMP) family.
Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743167TIMP2TIMP metallopeptidase inhibitor 29598VGNC:9705OMA, EggNOG
Mouse21858Timp2tissue inhibitor of metalloproteinase 210090MGI:98753Inparanoid, OMA, EggNOG
Rat29543Timp2TIMP metallopeptidase inhibitor 210116RGD:61312Inparanoid, OMA, EggNOG
Dog403633TIMP2TIMP metallopeptidase inhibitor 29615Inparanoid, EggNOG
Horse100034134TIMP2TIMP metallopeptidase inhibitor 29796OMA, EggNOG
Cow282093TIMP2TIMP metallopeptidase inhibitor 29913VGNC:35871Inparanoid, OMA, EggNOG
Pig396988TIMP2TIMP metallopeptidase inhibitor 29823OMA, EggNOG
Opossum100030996TIMP2TIMP metallopeptidase inhibitor 213616Inparanoid, OMA, EggNOG
Chicken374178TIMP2TIMP metallopeptidase inhibitor 29031CGNC:49073Inparanoid, OMA
Anole lizard100566015timp2TIMP metallopeptidase inhibitor 228377Inparanoid, OMA, EggNOG
Xenopus548477timp2TIMP metallopeptidase inhibitor 28364XB-GENE-949671Inparanoid, OMA, EggNOG
Zebrafish359835timp2aTIMP metallopeptidase inhibitor 2a7955ZDB-GENE-030612-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    protease inhibitor    /    Metalloproteinase inhibitor 2
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Metalloproteinase inhibitor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.