Protein or Target Summary
mRNA decay activator protein ZFP36L1
| Gene ID | 677 |
|---|---|
| uniprot | Q07352 |
| Gene Name | ZFP36L1 |
| Ensernbl ID | ENSP00000388402 |
| Sequence | MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 677 | ZFP36L1 | mRNA decay activator protein ZFP36L1 | Q07352 |
| MOUSE | Zfp36l1 | mRNA decay activator protein ZFP36L1 | A0A1W2P6I1 | |
| MOUSE | Zfp36l1 | mRNA decay activator protein ZFP36L1 | A0A1W2P7G3 | |
| MOUSE | Zfp36l1 | Zfp36l1 protein | Q91YI7 | |
| MOUSE | 12192 | Zfp36l1 | Zinc finger protein 36, C3H type-like 1 | Q543H2 |
| MOUSE | 12192 | Zfp36l1 | mRNA decay activator protein ZFP36L1 | P23950 |
| RAT | 29344 | Zfp36l1 | mRNA decay activator protein ZFP36L1 | P17431 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
protein / nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
protein / Nucleic acid binding / RNA binding protein / mRNA decay activator protein ZFP36L1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx