JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

PTGES3

Description	Prostaglandin E synthase 3

Gene and Protein Information

Gene ID	10728
Uniprot Accession IDs	A8K7D0 B4DHP2 B4DP11 B4DP21 Q8WU70
Ensembl ID	ENSP00000482075
Symbol	P23 TEBP P23 TEBP cPGES
Family	Belongs to the p23/wos2 family.
Sequence	MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746021	PTGES3	prostaglandin E synthase 3	9598	VGNC:5550	Inparanoid, OMA, EggNOG
Macaque	713353	PTGES3	prostaglandin E synthase 3	9544		OMA, EggNOG
Mouse	56351	Ptges3	prostaglandin E synthase 3	10090	MGI:1929282	Inparanoid, OMA, EggNOG
Rat	362809	Ptges3	prostaglandin E synthase 3	10116	RGD:1561913	Inparanoid, OMA, EggNOG
Horse	100059858	PTGES3	prostaglandin E synthase 3	9796	VGNC:21992	Inparanoid, OMA, EggNOG
Cow	493638	PTGES3	prostaglandin E synthase 3	9913	VGNC:33507	Inparanoid, OMA, EggNOG
Pig	100155956	PTGES3	prostaglandin E synthase 3	9823		OMA, EggNOG
Opossum	100014431	PTGES3	prostaglandin E synthase 3	13616		OMA, EggNOG
Anole lizard	100559049	ptges3	prostaglandin E synthase 3	28377		Inparanoid, OMA, EggNOG
Xenopus	492275	ptges3	prostaglandin E synthase 3	8364	XB-GENE-943096	Inparanoid, OMA, EggNOG
Zebrafish	406449	ptges3a	prostaglandin E synthase 3a (cytosolic)	7955	ZDB-GENE-040426-2200	Inparanoid, OMA, EggNOG
C. elegans	175727	daf-41	Co-chaperone protein daf-41	6239		Inparanoid, OMA, EggNOG

PANTHER Classes
protein / chaperone / Prostaglandin E synthase 3

DTO Classes
protein / Chaperone / Prostaglandin E synthase 3

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source