The store will not work correctly when cookies are disabled.
TGFA
| Description | Protransforming growth factor alpha |
|---|
Gene and Protein Information
| Gene ID | 7039 |
|---|
| Uniprot Accession IDs | A8K286 Q15577 Q53SK7 Q9BS56 Q9UEI3 Q9UKM1 Q9UKM2 Q9UKM3 |
|---|
| Ensembl ID | ENSP00000295400 |
|---|
| Symbol | TFGA |
|---|
| Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737080 | TGFA | transforming growth factor alpha | 9598 | VGNC:479 | OMA, EggNOG |
| Macaque | 613031 | TGFA | transforming growth factor alpha | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 21802 | Tgfa | transforming growth factor alpha | 10090 | MGI:98724 | Inparanoid, OMA, EggNOG |
| Rat | 24827 | Tgfa | transforming growth factor alpha | 10116 | RGD:3849 | Inparanoid, OMA, EggNOG |
| Horse | 100060423 | TGFA | transforming growth factor alpha | 9796 | VGNC:51415 | Inparanoid, OMA, EggNOG |
| Cow | | TGFA | transforming growth factor alpha [Source:HGNC Symbol;Acc:HGNC:11765] | 9913 | | OMA, EggNOG |
| Pig | 397484 | TGFA | transforming growth factor alpha | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100032790 | TGFA | transforming growth factor alpha | 13616 | | Inparanoid, EggNOG |
| Xenopus | 100485434 | tgfa | transforming growth factor alpha | 8364 | XB-GENE-852694 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100034402 | tgfa | transforming growth factor, alpha | 7955 | ZDB-GENE-040724-208 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
