The store will not work correctly when cookies are disabled.
TIA1
| Description | Nucleolysin TIA-1 isoform p40 |
|---|
Gene and Protein Information
| Gene ID | 7072 |
|---|
| Uniprot Accession IDs | Q53SS9 Q96B58 |
|---|
| Ensembl ID | ENSP00000401371 |
|---|
| Symbol | WDM TIA-1 |
|---|
| Sequence | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 459303 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9598 | | OMA, EggNOG |
| Macaque | 702366 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 21841 | Tia1 | cytotoxic granule-associated RNA binding protein 1 | 10090 | MGI:107914 | Inparanoid, OMA, EggNOG |
| Rat | 312510 | Tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 10116 | RGD:1305742 | Inparanoid, OMA |
| Dog | 610625 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9615 | VGNC:47363 | Inparanoid, OMA, EggNOG |
| Horse | | TIA1 | TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802] | 9796 | | OMA, EggNOG |
| Cow | 538533 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9913 | VGNC:35858 | Inparanoid, OMA, EggNOG |
| Opossum | 100032808 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 13616 | | Inparanoid, EggNOG |
| Chicken | 771327 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9031 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394890 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 8364 | XB-GENE-1002876 | Inparanoid, OMA, EggNOG |
| Zebrafish | 793165 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 7955 | ZDB-GENE-030131-1506 | Inparanoid, OMA, EggNOG |
| C. elegans | 173967 | tiar-1 | TIA-1/TIAL RNA binding protein homolog | 6239 | | OMA, EggNOG |
| S.cerevisiae | 855716 | PUB1 | Pub1p | 4932 | S000004961 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
