The store will not work correctly when cookies are disabled.
ATG4B
| Description | Cysteine protease ATG4B |
|---|
Gene and Protein Information
| Gene ID | 23192 |
|---|
| Uniprot Accession IDs | B7WNK2 Q53NU4 Q6ZUV8 Q8WYM9 Q96K07 Q96K96 Q96SZ1 Q9Y2F2 |
|---|
| Ensembl ID | ENSP00000384259 |
|---|
| Symbol | APG4B AUTL1 KIAA0943 APG4B AUTL1 |
|---|
| Family | Belongs to the peptidase C54 family. |
|---|
| Sequence | MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 748674 | ATG4B | autophagy related 4B cysteine peptidase | 9598 | VGNC:99 | OMA, EggNOG |
| Macaque | 717813 | ATG4B | autophagy related 4B cysteine peptidase | 9544 | | OMA, EggNOG |
| Mouse | 66615 | Atg4b | autophagy related 4B, cysteine peptidase | 10090 | MGI:1913865 | Inparanoid, OMA, EggNOG |
| Rat | 316640 | Atg4b | autophagy related 4B, cysteine peptidase | 10116 | RGD:1309664 | Inparanoid, OMA |
| Dog | 609599 | ATG4B | autophagy related 4B cysteine peptidase | 9615 | VGNC:49762 | Inparanoid, OMA, EggNOG |
| Cow | 408002 | ATG4B | autophagy related 4B cysteine peptidase | 9913 | VGNC:26258 | Inparanoid, OMA, EggNOG |
| Opossum | 100012560 | ATG4B | autophagy related 4B cysteine peptidase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100082445 | ATG4B | autophagy related 4B cysteine peptidase | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 404750 | ATG4B | autophagy related 4B cysteine peptidase | 9031 | CGNC:49878 | Inparanoid, OMA |
| Anole lizard | 100560042 | atg4b | autophagy related 4B cysteine peptidase | 28377 | | Inparanoid, OMA |
| Xenopus | 779919 | atg4b | autophagy related 4B, cysteine peptidase | 8364 | XB-GENE-967111 | Inparanoid, OMA |
| Zebrafish | 448859 | atg4b | autophagy related 4B, cysteine peptidase | 7955 | ZDB-GENE-040917-3 | Inparanoid, OMA |
| C. elegans | 190777 | atg-4.1 | Cysteine protease | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
