The store will not work correctly when cookies are disabled.
APRT
| Description | Adenine phosphoribosyltransferase |
|---|
Gene and Protein Information
| Gene ID | 353 |
|---|
| Uniprot Accession IDs | G5E9J2 Q3KP55 Q68DF9 APRT |
|---|
| Ensembl ID | ENSP00000367615 |
|---|
| Symbol | AMP APRTD |
|---|
| Family | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
|---|
| Sequence | MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736305 | APRT | adenine phosphoribosyltransferase | 9598 | VGNC:5673 | OMA, EggNOG |
| Macaque | 697715 | APRT | adenine phosphoribosyltransferase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 11821 | Aprt | adenine phosphoribosyl transferase | 10090 | MGI:88061 | Inparanoid, OMA, EggNOG |
| Rat | 292072 | Aprt | adenine phosphoribosyl transferase | 10116 | RGD:1307758 | Inparanoid, OMA, EggNOG |
| Dog | 479615 | APRT | adenine phosphoribosyltransferase | 9615 | VGNC:38014 | Inparanoid, OMA, EggNOG |
| Horse | 100051212 | APRT | adenine phosphoribosyltransferase | 9796 | VGNC:51140 | Inparanoid, OMA, EggNOG |
| Cow | 519017 | APRT | adenine phosphoribosyltransferase | 9913 | VGNC:26042 | Inparanoid, OMA, EggNOG |
| Pig | 100622001 | APRT | adenine phosphoribosyltransferase | 9823 | | OMA, EggNOG |
| Opossum | 100019032 | APRT | adenine phosphoribosyltransferase | 13616 | | Inparanoid, EggNOG |
| Platypus | 100080901 | APRT | adenine phosphoribosyltransferase | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556354 | aprt | adenine phosphoribosyltransferase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 493317 | aprt | adenine phosphoribosyltransferase | 8364 | XB-GENE-5848953 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393641 | aprt | adenine phosphoribosyltransferase | 7955 | ZDB-GENE-040426-1492 | Inparanoid, OMA, EggNOG |
| C. elegans | 172232 | T19B4.3 | Adenine phosphoribosyltransferase | 6239 | | Inparanoid, OMA |
| Fruitfly | 48224 | Aprt | Adenine phosphoribosyltransferase | 7227 | FBgn0000109 | Inparanoid, EggNOG |
| S.cerevisiae | 854986 | APT1 | adenine phosphoribosyltransferase APT1 | 4932 | S000004484 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
