The store will not work correctly when cookies are disabled.
APOC1
| Description | Apolipoprotein C-I |
|---|
Gene and Protein Information
| Gene ID | 341 |
|---|
| Uniprot Accession IDs | B2R526 Q6IB97 Apo-CI |
|---|
| Ensembl ID | ENSP00000465356 |
|---|
| Symbol | Apo-CI ApoC-I apo-CIB apoC-IB |
|---|
| Family | Belongs to the apolipoprotein C1 family. |
|---|
| Sequence | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
