Protein or Target Summary
Cyclic AMP-dependent transcription factor ATF-3
| Gene ID | 467 |
|---|---|
| uniprot | P18847 |
| Gene Name | ATF3 |
| Ensernbl ID | ENSP00000344352 |
| Family | Belongs to the bZIP family. ATF subfamily. |
| Sequence | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 467 | ATF3 | Cyclic AMP-dependent transcription factor ATF-3 | P18847 |
| MOUSE | Atf3 | Activating transcription factor ATF3b | Q7TPG4 | |
| MOUSE | Atf3 | TI-241 | Q62281 | |
| MOUSE | 11910 | Atf3 | Activating transcription factor 3 | Q4FJW1 |
| MOUSE | 11910 | Atf3 | Cyclic AMP-dependent transcription factor ATF-3 | Q60765 |
| RAT | 25389 | Atf3 | Cyclic AMP-dependent transcription factor ATF-3 | P29596 |
Protein Classes
PANTHER Classes
protein / basic leucine zipper transcription factor / Cyclic AMP-dependent transcription factor ATF-3
protein / basic leucine zipper transcription factor / Cyclic AMP-dependent transcription factor ATF-3
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Cyclic AMP-dependent transcription factor ATF-3
protein / Transcription factor / Basic leucine zipper transcription factor / Cyclic AMP-dependent transcription factor ATF-3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx