JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
ATP5PD

ATP5PD

Description	ATP synthase subunit d, mitochondrial

Gene and Protein Information

Gene ID	10476
Uniprot Accession IDs	B2R5L6 Q9H3J4 ATPase subunit d
Ensembl ID	ENSP00000301587
Symbol	ATP5H ATPQ APT5H ATP5H
Family	Belongs to the ATPase d subunit family.
Sequence	MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736468	ATP5PD	ATP synthase peripheral stalk subunit d	9598	VGNC:9225	OMA, EggNOG
Macaque	700338	ATP5PD	ATP synthase peripheral stalk subunit d	9544		OMA, EggNOG
Horse	100052170	ATP5PD	ATP synthase peripheral stalk subunit d	9796	VGNC:15662	OMA, EggNOG
Cow	282710	ATP5PD	ATP synthase peripheral stalk subunit d	9913		Inparanoid, OMA, EggNOG
Opossum	100023278	ATP5PD	ATP synthase peripheral stalk subunit d	13616		OMA, EggNOG
Platypus	100085769	ATP5PD	ATP synthase peripheral stalk subunit d	9258		OMA, EggNOG
Chicken	422115	ATP5H	ATP synthase, H+ transporting, mitochondrial Fo complex subunit D	9031	CGNC:5993	Inparanoid, OMA, EggNOG
Anole lizard	100565813	atp5pd	ATP synthase peripheral stalk subunit d	28377		OMA, EggNOG
Xenopus	496430	atp5pd	ATP synthase peripheral stalk subunit d	8364	XB-GENE-993879	OMA, EggNOG
Fruitfly	42291	ATPsynD	ATP synthase, subunit D	7227	FBgn0016120	Inparanoid, EggNOG

Protein Classes

DTO Classes
protein / Transporter / F-type and V-type ATPases / F-type ATPase / ATP synthase subunit d, mitochondrial

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]