JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Aflatoxin B1 aldehyde reductase member 3

Gene ID	22977
uniprot	O95154
Gene Name	AKR7A3
Ensernbl ID	ENSP00000355377
Family	Belongs to the aldo/keto reductase family. Aldo/keto reductase 2 subfamily.
Sequence	MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	22977	AKR7A3	Aflatoxin B1 aldehyde reductase member 3	O95154
RAT	26760	Akr7a3	Aflatoxin B1 aldehyde reductase member 3	P38918

Protein Classes

PANTHER Classes
protein / oxidoreductase / reductase / Aflatoxin B1 aldehyde reductase member 3

DTO Classes
protein / Enzyme / Oxidoreductase / Reductase / Aflatoxin B1 aldehyde reductase member 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx