Protein or Target Summary
Set1/Ash2 histone methyltransferase complex subunit ASH2
| Gene ID | 9070 |
|---|---|
| uniprot | Q9UBL3 |
| Gene Name | ASH2L |
| Ensernbl ID | ENSP00000340896 |
| Sequence | MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 9070 | ASH2L | Set1/Ash2 histone methyltransferase complex subunit ASH2 | Q9UBL3 |
| MOUSE | 23808 | Ash2l | Uncharacterized protein | Q3UJ62 |
| MOUSE | Ash2l | Set1/Ash2 histone methyltransferase complex subunit ASH2 | D6RI55 | |
| MOUSE | Ash2l | Uncharacterized protein | Q3UJY9 | |
| MOUSE | Ash2l | Set1/Ash2 histone methyltransferase complex subunit ASH2 | D6RET1 | |
| MOUSE | Ash2l | Set1/Ash2 histone methyltransferase complex subunit ASH2 | D3YYA0 | |
| MOUSE | 23808 | Ash2l | Uncharacterized protein | Q3UKZ9 |
| MOUSE | 23808 | Ash2l | Set1/Ash2 histone methyltransferase complex subunit ASH2 | E9PU93 |
| MOUSE | 23808 | Ash2l | Set1/Ash2 histone methyltransferase complex subunit ASH2 | Q91X20 |
| RAT | 290829 | Ash2l | ASH2-like histone lysine methyltransferase complex subunit | A0A0G2JT90 |
| RAT | 290829 | Ash2l | ASH2-like histone lysine methyltransferase complex subunit | D3ZTV7 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
protein / nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
DTO Classes
protein / Nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
protein / Nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx