ASH2L

Description	Set1/Ash2 histone methyltransferase complex subunit ASH2

Gene and Protein Information

Gene ID	9070
Uniprot Accession IDs	A8K7C3 D3DSW9 O60659 O60660 Q96B62
Ensembl ID	ENSP00000340896
Symbol	ASH2L1 ASH2 Bre2 ASH2L1 ASH2L2
Sequence	MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464115	ASH2L	ASH2 like, histone lysine methyltransferase complex subunit	9598	VGNC:10321	OMA, EggNOG
Macaque	699382	ASH2L	ASH2 like histone lysine methyltransferase complex subunit	9544		Inparanoid, OMA, EggNOG
Mouse	23808	Ash2l	ASH2 like histone lysine methyltransferase complex subunit	10090	MGI:1344416	Inparanoid, OMA, EggNOG
Rat	290829	Ash2l	ASH2 like histone lysine methyltransferase complex subunit	10116	RGD:1305632	Inparanoid, OMA, EggNOG
Dog	475589	ASH2L	ASH2 like, histone lysine methyltransferase complex subunit	9615	VGNC:50623	Inparanoid, OMA, EggNOG
Horse	100059465	ASH2L	ASH2 like, histone lysine methyltransferase complex subunit	9796	VGNC:50586	Inparanoid, OMA, EggNOG
Cow	100138350	ASH2L	ASH2 like, histone lysine methyltransferase complex subunit	9913	VGNC:49156	Inparanoid, OMA, EggNOG
Pig	100627423	ASH2L	ASH2 like histone lysine methyltransferase complex subunit	9823		Inparanoid, OMA, EggNOG
Opossum	100029781	ASH2L	ASH2 like histone lysine methyltransferase complex subunit	13616		Inparanoid, EggNOG
Chicken	426774	ASH2L	ASH2 like histone lysine methyltransferase complex subunit	9031	CGNC:2347	Inparanoid, OMA, EggNOG
Anole lizard	100554381	ash2l	ASH2 like histone lysine methyltransferase complex subunit	28377		Inparanoid, OMA, EggNOG
Xenopus	100492052	ash2l	ASH2 like, histone lysine methyltransferase complex subunit	8364	XB-GENE-923264	Inparanoid, OMA, EggNOG
Zebrafish	558193	ash2l	ash2 like, histone lysine methyltransferase complex subunit	7955	ZDB-GENE-030131-494	Inparanoid, OMA, EggNOG
C. elegans	174838	ash-2	ASH histone methyltransferase complex subunit (Drosophila absent, small or homeotic discs)	6239		Inparanoid, OMA, EggNOG
Fruitfly	42936	ash2	absent, small, or homeotic discs 2	7227	FBgn0000139	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source