JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

PDE6H

Description	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

Gene and Protein Information

Gene ID	5149
Uniprot Accession IDs	Q52LY7 GMP-PDE gamma
Ensembl ID	ENSP00000266395
Symbol	RCD3 ACHM6
Family	Belongs to the rod/cone cGMP-PDE gamma subunit family.
Sequence	MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	742049	PDE6H	phosphodiesterase 6H	9598	VGNC:5527	OMA, EggNOG
Mouse	78600	Pde6h	phosphodiesterase 6H, cGMP-specific, cone, gamma	10090	MGI:1925850	OMA, EggNOG
Rat	114248	Pde6h	phosphodiesterase 6H	10116	RGD:70933	OMA, EggNOG
Dog	611031	PDE6H	phosphodiesterase 6H	9615	VGNC:44362	OMA, EggNOG
Horse	100629178	PDE6H	phosphodiesterase 6H	9796	VGNC:21253	OMA, EggNOG
Cow	281978	PDE6H	phosphodiesterase 6H	9913	VGNC:32684	OMA, EggNOG
Opossum	100011684	PDE6H	phosphodiesterase 6H	13616		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / hydrolase / esterase / Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
protein / hydrolase / phosphodiesterase / Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

DTO Classes
protein / Enzyme / Hydrolase / Esterase / Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]