Protein or Target Summary
Sodium/potassium-transporting ATPase subunit beta-3
| Gene ID | 483 |
|---|---|
| uniprot | P54709 |
| Gene Name | ATP1B3 |
| Ensernbl ID | ENSP00000286371 |
| Family | Belongs to the X(+)/potassium ATPases subunit beta family. |
| Sequence | MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 483 | ATP1B3 | Sodium/potassium-transporting ATPase subunit beta-3 | P54709 |
| MOUSE | Atp1b3 | Atp1b3 protein | Q1WWL1 | |
| MOUSE | Atp1b3 | Sodium/potassium-transporting ATPase subunit beta | Q3U9D4 | |
| MOUSE | atp1b3 | Na K-ATPase beta-3 subunit | Q71VC6 | |
| MOUSE | Atp1b3 | Uncharacterized protein | Q3UFH4 | |
| MOUSE | 11933 | Atp1b3 | Sodium/potassium-transporting ATPase subunit beta | Q544Q7 |
| MOUSE | 11933 | Atp1b3 | Sodium/potassium-transporting ATPase subunit beta-3 | P97370 |
| RAT | 25390 | Atp1b3 | Sodium/potassium-transporting ATPase subunit beta-3 | Q63377 |
Protein Classes
PANTHER Classes
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-3
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-3
DTO Classes
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-3
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx