The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cyclic AMP-dependent transcription factor ATF-4
| Gene ID | 468 |
|---|
| uniprot | P18848 |
|---|
| Gene Name | ATF4 |
|---|
| Ensernbl ID | ENSP00000336790 |
|---|
| Family | Belongs to the bZIP family. |
|---|
| Sequence | MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 468 | ATF4 | Cyclic AMP-dependent transcription factor ATF-4 | P18848 |
| MOUSE | | Atf4 | ATF4 | Q794G7 |
| MOUSE | | Atf4 | Activating transcriptionn factor 4 | Q61328 |
| MOUSE | | Atf4 | Uncharacterized protein | Q3TZI8 |
| MOUSE | | Atf4 | Cyclic AMP-dependent transcription factor ATF-4 | A0A2R8VI82 |
| MOUSE | | Atf4 | Uncharacterized protein | Q3U2J1 |
| MOUSE | 11911 | Atf4 | Uncharacterized protein | Q8CF69 |
| MOUSE | 11911 | Atf4 | Cyclic AMP-dependent transcription factor ATF-4 | Q06507 |
| RAT | 79255 | Atf4 | Activating transcription factor 4 (Tax-responsive enhancer element B67) | B0BMW3 |
| RAT | 79255 | Atf4 | Cyclic AMP-dependent transcription factor ATF-4 | Q9ES19 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
