JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Chloride intracellular channel protein 3

Gene ID	9022
uniprot	O95833
Gene Name	CLIC3
Ensernbl ID	ENSP00000419378
Family	Belongs to the chloride channel CLIC family.
Sequence	MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9022	CLIC3	Chloride intracellular channel protein 3	O95833
MOUSE		Clic3	Chloride intracellular channel protein	Q6P912
MOUSE		Clic3	Chloride intracellular channel protein	A2AJ28
MOUSE	69454	Clic3	Chloride intracellular channel protein 3	Q9D7P7
RAT	296566	Clic3	Chloride intracellular channel protein	D3ZY91

Protein Classes

DTO Classes
protein / Ion channel / Intracellular chloride channel (clic) family / Chloride intracellular channel protein 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx