The store will not work correctly when cookies are disabled.
Protein or Target Summary
Chloride intracellular channel protein 4
| Gene ID | 25932 |
|---|
| uniprot | Q9Y696 |
|---|
| Gene Name | CLIC4 |
|---|
| Ensernbl ID | ENSP00000363500 |
|---|
| Family | Belongs to the chloride channel CLIC family. |
|---|
| Sequence | MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 25932 | CLIC4 | Chloride intracellular channel protein 4 | Q9Y696 |
| MOUSE | 29876 | Clic4 | Chloride intracellular channel protein | Q543N5 |
| MOUSE | | Clic4 | Uncharacterized protein | Q3U8I1 |
| MOUSE | 29876 | Clic4 | Chloride intracellular channel protein 4 | Q9QYB1 |
| RAT | | Clic4 | Chloride intracellular channel protein | G3V8C4 |
| RAT | | Clic4 | Chloride intracellular channel protein | A3FM27 |
| RAT | 83718 | Clic4 | Chloride intracellular channel protein 4 | Q9Z0W7 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
