Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

CLIC4

DescriptionChloride intracellular channel protein 4

Gene and Protein Information

Gene ID25932
Uniprot Accession IDs Q9UFW9 Q9UQJ6
Ensembl ID ENSP00000363500
Symbol H1 huH1 p64H1 CLIC4L MTCLIC
FamilyBelongs to the chloride channel CLIC family.
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp749398CLIC4chloride intracellular channel 49598VGNC:10579OMA, EggNOG
Macaque712337CLIC4chloride intracellular channel 49544Inparanoid, OMA
Mouse29876Clic4chloride intracellular channel 4 (mitochondrial)10090MGI:1352754Inparanoid, OMA, EggNOG
Rat83718Clic4chloride intracellular channel 410116RGD:61857Inparanoid, OMA, EggNOG
Dog487367CLIC4chloride intracellular channel 49615VGNC:39340Inparanoid, OMA
Horse100071457CLIC4chloride intracellular channel 49796VGNC:16613Inparanoid, OMA
Cow286823CLIC4chloride intracellular channel 49913VGNC:27442Inparanoid, OMA
Opossum100012549CLIC4chloride intracellular channel 413616Inparanoid, OMA
Chicken419595CLIC4chloride intracellular channel 49031CGNC:861Inparanoid, OMA
Anole lizard100552159clic4chloride intracellular channel 428377Inparanoid, OMA
Zebrafish368255clic4chloride intracellular channel 47955ZDB-GENE-030326-3Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.