Protein or Target Summary

Cold-inducible RNA-binding protein

Gene ID	1153
uniprot	Q14011
Gene Name	CIRBP
Ensernbl ID	ENSP00000466897
Sequence	MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1153	CIRBP	Cold-inducible RNA-binding protein	Q14011
MOUSE		Cirbp	Cold-inducible RNA-binding protein	D3YU80
MOUSE		Cirbp	Cold inducible RNA binding protein, isoform CRA_a	K4DI65
MOUSE	12696	Cirbp	Cold-inducible RNA-binding protein	P60824
RAT	81825	Cirbp	Cold inducible RNA binding protein	Q6NT88
RAT	81825	Cirbp	Cold-inducible RNA-binding protein	P60825

Protein Classes

PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Cold-inducible RNA-binding protein

DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Cold-inducible RNA-binding protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx