The store will not work correctly when cookies are disabled.
Protein or Target Summary
CDGSH iron-sulfur domain-containing protein 1
| Gene ID | 55847 |
|---|
| uniprot | Q9NZ45 |
|---|
| Gene Name | CISD1 |
|---|
| Ensernbl ID | ENSP00000363041 |
|---|
| Family | Belongs to the CISD protein family. |
|---|
| Sequence | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 55847 | CISD1 | CDGSH iron-sulfur domain-containing protein 1 | Q9NZ45 |
| MOUSE | 52637 | Cisd1 | CDGSH iron-sulfur domain-containing protein 1 | Q91WS0 |
| RAT | 294362 | Cisd1 | CDGSH iron-sulfur domain-containing protein 1 | B0K020 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
