The store will not work correctly when cookies are disabled.
CISD1
| Description | CDGSH iron-sulfur domain-containing protein 1 |
|---|
Gene and Protein Information
| Gene ID | 55847 |
|---|
| Uniprot Accession IDs | Q1X902 |
|---|
| Ensembl ID | ENSP00000363041 |
|---|
| Symbol | C10orf70 ZCD1 ZCD1 MDS029 C10orf70 mitoNEET |
|---|
| Family | Belongs to the CISD protein family. |
|---|
| Sequence | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 748227 | CISD1 | CDGSH iron sulfur domain 1 | 9598 | VGNC:51970 | OMA, EggNOG |
| Macaque | 701716 | CISD1 | CDGSH iron sulfur domain 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 52637 | Cisd1 | CDGSH iron sulfur domain 1 | 10090 | MGI:1261855 | Inparanoid, OMA, EggNOG |
| Rat | 294362 | Cisd1 | CDGSH iron sulfur domain 1 | 10116 | RGD:1309529 | Inparanoid, OMA, EggNOG |
| Horse | 100072162 | CISD1 | CDGSH iron sulfur domain 1 | 9796 | | OMA, EggNOG |
| Cow | 531444 | CISD1 | CDGSH iron sulfur domain 1 | 9913 | VGNC:27371 | Inparanoid, OMA, EggNOG |
| Pig | 100520401 | LOC100520401 | CDGSH iron-sulfur domain-containing protein 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100024488 | CISD1 | CDGSH iron sulfur domain 1 | 13616 | | Inparanoid, EggNOG |
| Platypus | | CISD1 | CDGSH iron sulfur domain 1 [Source:HGNC Symbol;Acc:HGNC:30880] | 9258 | | OMA, EggNOG |
| Chicken | 423642 | CISD1 | CDGSH iron sulfur domain 1 | 9031 | CGNC:1950 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559354 | cisd1 | CDGSH iron sulfur domain 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448057 | cisd1 | CDGSH iron sulfur domain 1 | 8364 | XB-GENE-973366 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393577 | cisd1 | CDGSH iron sulfur domain 1 | 7955 | ZDB-GENE-040426-1162 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
