Protein or Target Summary

C-type lectin domain family 4 member M

Gene ID	10332
uniprot	Q9H2X3
Gene Name	CLEC4M
Ensernbl ID	ENSP00000316228
Sequence	MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10332	CLEC4M	C-type lectin domain family 4 member M	Q9H2X3
RAT	288378	Clec4m	Cd209b protein	Q5BK08
RAT	288378	Clec4m	C-type lectin domain family 4 member M	F1LM87

Protein Classes

PANTHER Classes
protein    /    receptor    /    cell adhesion molecule    /    C-type lectin domain family 4 member M
protein    /    receptor    /    immunoglobulin receptor superfamily    /    C-type lectin domain family 4 member M
protein    /    receptor    /    defense/immunity protein    /    C-type lectin domain family 4 member M
protein    /    receptor    /    cytokine receptor    /    C-type lectin domain family 4 member M

DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / C-type lectin domain family 4 member M

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx