Protein or Target Summary
Sodium/potassium-transporting ATPase subunit beta-1
Gene ID | 481 |
---|---|
uniprot | P05026 |
Gene Name | ATP1B1 |
Ensernbl ID | ENSP00000356790 |
Family | Belongs to the X(+)/potassium ATPases subunit beta family. |
Sequence | MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 481 | ATP1B1 | Sodium/potassium-transporting ATPase subunit beta-1 | P05026 |
MOUSE | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta | Q3TSQ1 | |
MOUSE | Atp1b1 | ATPase Na+/K+ transporting beta 1 polypeptide | B0LAB6 | |
MOUSE | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta | A0A0A6YX05 | |
MOUSE | 11931 | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta | Q3TV47 |
MOUSE | Atp1b1 | Uncharacterized protein | Q3TRA6 | |
MOUSE | 11931 | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta | Q545P0 |
MOUSE | 11931 | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta-1 | P14094 |
RAT | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta | A0A096MJI9 | |
RAT | 25650 | Atp1b1 | Sodium/potassium-transporting ATPase subunit beta-1 | P07340 |
Protein Classes
PANTHER Classes
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-1
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-1
DTO Classes
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-1
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx