The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ubiquitin-like protein ATG12
| Gene ID | 9140 |
|---|
| uniprot | O94817 |
|---|
| Gene Name | ATG12 |
|---|
| Ensernbl ID | ENSP00000425107 |
|---|
| Family | Belongs to the ATG12 family. |
|---|
| Sequence | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 9140 | ATG12 | Ubiquitin-like protein ATG12 | O94817 |
| MOUSE | 67526 | Atg12 | Ubiquitin-like protein ATG12 | Q9CQY1 |
| RAT | 361321 | Atg12 | Ubiquitin-like protein ATG12 | Q2TBJ5 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
