Protein or Target Summary
Actin-related protein 3
| Gene ID | 10096 |
|---|---|
| uniprot | P61158 |
| Gene Name | ACTR3 |
| Ensernbl ID | ENSP00000263238 |
| Family | Belongs to the actin family. ARP3 subfamily. |
| Sequence | MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 10096 | ACTR3 | Actin-related protein 3 | P61158 |
| MOUSE | Actr3 | Actin-related protein 3 | Q9ERF8 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WRA1 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WPR6 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WS98 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WP86 | |
| MOUSE | Actr3 | Uncharacterized protein | Q3TGE1 | |
| MOUSE | Actr3 | Uncharacterized protein | Q3TWJ4 | |
| MOUSE | Actr3 | Uncharacterized protein | Q3TGW0 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WQ83 | |
| MOUSE | Actr3 | Uncharacterized protein | Q3UGH0 | |
| MOUSE | Actr3 | Actin-related protein 3 | A0A087WQ14 | |
| MOUSE | 74117 | Actr3 | MCG1196 | Q3ULF7 |
| MOUSE | 74117 | Actr3 | Actin-related protein 3 | Q99JY9 |
| RAT | Actr3 | Actin-related protein 3 | A0A0G2K1C0 | |
| RAT | 81732 | Actr3 | Actin-related protein 3 | Q4V7C7 |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / actin and actin related protein / Actin-related protein 3
protein / cytoskeletal protein / actin and actin related protein / Actin-related protein 3
DTO Classes
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Actin-related protein 3
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Actin-related protein 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx