JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

ARG1

Description	Arginase-1

Gene and Protein Information

Gene ID	383
Uniprot Accession IDs	A6NEA0 Q5JWT5 Q5JWT6 Q8TE72 Q9BS50
Ensembl ID	ENSP00000349446
Family	Belongs to the arginase family.
Sequence	MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462999	ARG1	arginase 1	9598	VGNC:11033	OMA, EggNOG
Macaque	710410	ARG1	arginase 1	9544		Inparanoid, OMA
Mouse	11846	Arg1	arginase, liver	10090	MGI:88070	Inparanoid, OMA, EggNOG
Rat	29221	Arg1	arginase 1	10116	RGD:2150	Inparanoid, OMA, EggNOG
Dog	474823	ARG1	arginase 1	9615	VGNC:38041	Inparanoid, OMA
Horse	100073086	ARG1	arginase 1	9796	VGNC:15454	Inparanoid, OMA
Cow	513608	ARG1	arginase 1	9913	VGNC:26070	Inparanoid, OMA, EggNOG
Pig	397115	ARG1	arginase 1	9823		Inparanoid, OMA
Opossum	100031015	ARG1	arginase 1	13616		Inparanoid, OMA, EggNOG
Platypus		ARG1	arginase 1 [Source:HGNC Symbol;Acc:HGNC:663]	9258		OMA, EggNOG
Xenopus	448358	arg1	arginase 1	8364	XB-GENE-966913	Inparanoid, OMA
Fruitfly	46717	arg	arginase	7227	FBgn0023535	Inparanoid, EggNOG
S.cerevisiae	855993	CAR1	arginase	4932	S000006032	OMA, EggNOG

PANTHER Classes
protein / hydrolase / Arginase-1

DTO Classes
protein / Enzyme / Hydrolase / Arginase-1

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source