The store will not work correctly when cookies are disabled.
PMAIP1
| Description | Phorbol-12-myristate-13-acetate-induced protein 1 |
|---|
Gene and Protein Information
| Gene ID | 5366 |
|---|
| Uniprot Accession IDs | B2R4T7 Q8N589 PMA-induced protein 1 |
|---|
| Ensembl ID | ENSP00000326119 |
|---|
| Symbol | NOXA APR NOXA |
|---|
| Family | Belongs to the PMAIP1 family. |
|---|
| Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Dog | 100502558 | PMAIP1 | phorbol-12-myristate-13-acetate-induced protein 1 | 9615 | VGNC:53752 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
