The store will not work correctly when cookies are disabled.
Protein or Target Summary
Phorbol-12-myristate-13-acetate-induced protein 1
| Gene ID | 5366 |
|---|
| uniprot | Q13794 |
|---|
| Gene Name | PMAIP1 |
|---|
| Ensernbl ID | ENSP00000326119 |
|---|
| Family | Belongs to the PMAIP1 family. |
|---|
| Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5366 | PMAIP1 | Phorbol-12-myristate-13-acetate-induced protein 1 | Q13794 |
| MOUSE | 58801 | Pmaip1 | Phorbol-12-myristate-13-acetate-induced protein 1 | Q9JM54 |
| RAT | 492821 | Pmaip1 | Phorbol-12-myristate-13-acetate-induced protein 1 | Q5U777 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
