The store will not work correctly when cookies are disabled.
ARL17A
| Description | ADP-ribosylation factor-like protein 17 |
|---|
Gene and Protein Information
| Gene ID | 100506084 |
|---|
| Uniprot Accession IDs | B0AZR6 Q59FW5 Q8N6E2 Q8TD73 Q8WW54 Q9NZD5 Q9P158 |
|---|
| Ensembl ID | ENSP00000404247 |
|---|
| Symbol | ARL17P1 ARL17 ARL17A |
|---|
| Family | Belongs to the small GTPase superfamily. Arf family. |
|---|
| Sequence | MGNIFEKLFKSLLGKKKMRILILSLDTAGKTTILYKLKLGETVPAVPTVGFCVETVEYKNNTFAVWDVGSHFKIRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVK |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
