JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

GNRHR2

Description	Putative gonadotropin-releasing hormone II receptor

Gene and Protein Information

Gene ID	114814
Uniprot Accession IDs	E7EN27 Q8TCX8 GnRH II receptor
Symbol	GnRH-II-R
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / Putative gonadotropin-releasing hormone ii receptor

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Gonadotrophin-releasing hormone receptor / Putative gonadotropin-releasing hormone ii receptor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]