The store will not work correctly when cookies are disabled.
GPR174
| Description | Probable G-protein coupled receptor 174 |
|---|
Gene and Protein Information
| Gene ID | 84636 |
|---|
| Uniprot Accession IDs | Q2M3F7 |
|---|
| Ensembl ID | ENSP00000276077 |
|---|
| Symbol | FKSG79 GPCR17 LYPSR3 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100613557 | GPR174 | G protein-coupled receptor 174 | 9598 | VGNC:12374 | OMA, EggNOG |
| Mouse | 213439 | Gpr174 | G protein-coupled receptor 174 | 10090 | MGI:2685222 | Inparanoid, OMA, EggNOG |
| Rat | 302373 | Gpr174 | G protein-coupled receptor 174 | 10116 | RGD:1564689 | Inparanoid, OMA, EggNOG |
| Dog | 100683878 | GPR174 | G protein-coupled receptor 174 | 9615 | VGNC:41417 | Inparanoid, OMA, EggNOG |
| Horse | 100071745 | GPR174 | G protein-coupled receptor 174 | 9796 | VGNC:18528 | Inparanoid, OMA, EggNOG |
| Cow | 781056 | GPR174 | G protein-coupled receptor 174 | 9913 | VGNC:29571 | Inparanoid, OMA, EggNOG |
| Pig | 102160665 | GPR174 | G protein-coupled receptor 174 | 9823 | | OMA, EggNOG |
| Opossum | 100020404 | GPR174 | G protein-coupled receptor 174 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | GPR174 | G protein-coupled receptor 174 [Source:HGNC Symbol;Acc:HGNC:30245] | 9258 | | OMA, EggNOG |
| Chicken | 422146 | GPR174 | G protein-coupled receptor 174 | 9031 | CGNC:3016 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563634 | gpr174 | G protein-coupled receptor 174 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | | gpr174 | G protein-coupled receptor 174 [Source:Xenbase;Acc:XB-GENE-994529] | 8364 | | OMA, EggNOG |
| Zebrafish | 100151331 | gpr174 | G protein-coupled receptor 174 | 7955 | ZDB-GENE-100930-1 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
