Protein or Target Summary
G-protein coupled bile acid receptor 1
Gene ID | 151306 |
---|---|
uniprot | Q8TDU6 |
Gene Name | GPBAR1 |
Ensernbl ID | ENSP00000430886 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 151306 | GPBAR1 | G-protein coupled bile acid receptor 1 | Q8TDU6 |
MOUSE | 227289 | Gpbar1 | G protein-coupled bile acid receptor 1 | Q14AA9 |
MOUSE | 227289 | Gpbar1 | G-protein coupled bile acid receptor 1 | Q80SS6 |
RAT | 338443 | Gpbar1 | G protein-coupled bile acid receptor 1 | U5JAP5 |
RAT | 338443 | Gpbar1 | G-protein coupled bile acid receptor 1 | Q80T02 |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx