GPBAR1

Description	G-protein coupled bile acid receptor 1

Gene and Protein Information

Gene ID	151306
Uniprot Accession IDs	B3KV35
Ensembl ID	ENSP00000430886
Symbol	TGR5 BG37 TGR5 M-BAR GPCR19 GPR131
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	741111	GPBAR1	G protein-coupled bile acid receptor 1	9598	VGNC:50730	OMA, EggNOG
Macaque	697937	GPBAR1	G protein-coupled bile acid receptor 1	9544		Inparanoid, OMA
Mouse	227289	Gpbar1	G protein-coupled bile acid receptor 1	10090	MGI:2653863	Inparanoid, OMA, EggNOG
Rat	338443	Gpbar1	G protein-coupled bile acid receptor 1	10116	RGD:631400	Inparanoid, OMA
Horse	100055590	GPBAR1	G protein-coupled bile acid receptor 1	9796	VGNC:18482	Inparanoid, OMA, EggNOG
Cow	317756	GPBAR1	G protein-coupled bile acid receptor 1	9913	VGNC:29521	Inparanoid, OMA, EggNOG
Opossum	100011968	GPBAR1	G protein-coupled bile acid receptor 1	13616		Inparanoid, OMA, EggNOG
Anole lizard	100566467	gpbar1	G protein-coupled bile acid receptor 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100488432	gpbar1	G protein-coupled bile acid receptor 1	8364	XB-GENE-959591	Inparanoid, OMA, EggNOG
Zebrafish	797190	gpbar1	G protein-coupled bile acid receptor 1	7955	ZDB-GENE-120315-1	OMA, EggNOG

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]