Protein or Target Summary
G-protein coupled bile acid receptor 1
| Gene ID | 151306 |
|---|---|
| uniprot | Q8TDU6 |
| Gene Name | GPBAR1 |
| Ensernbl ID | ENSP00000430886 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 151306 | GPBAR1 | G-protein coupled bile acid receptor 1 | Q8TDU6 |
| MOUSE | 227289 | Gpbar1 | G protein-coupled bile acid receptor 1 | Q14AA9 |
| MOUSE | 227289 | Gpbar1 | G-protein coupled bile acid receptor 1 | Q80SS6 |
| RAT | 338443 | Gpbar1 | G protein-coupled bile acid receptor 1 | U5JAP5 |
| RAT | 338443 | Gpbar1 | G-protein coupled bile acid receptor 1 | Q80T02 |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx