JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

EDNRA

Description	Endothelin-1 receptor

Gene and Protein Information

Gene ID	1909
Uniprot Accession IDs	B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2
Ensembl ID	ENSP00000315011
Symbol	ETA ETRA ETA ET-A ETAR ETRA MFDA ETA-R hET-AR
Family	Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Sequence	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461530	EDNRA	endothelin receptor type A	9598	VGNC:594	OMA, EggNOG
Macaque	704135	EDNRA	endothelin receptor type A	9544		Inparanoid, OMA, EggNOG
Mouse	13617	Ednra	endothelin receptor type A	10090	MGI:105923	Inparanoid, OMA, EggNOG
Rat	24326	Ednra	endothelin receptor type A	10116	RGD:2535	Inparanoid, OMA, EggNOG
Dog	450187	EDNRA	endothelin receptor type A	9615	VGNC:40202	Inparanoid, OMA, EggNOG
Horse	100062644	EDNRA	endothelin receptor type A	9796	VGNC:17424	Inparanoid, OMA, EggNOG
Cow	281749	EDNRA	endothelin receptor type A	9913	VGNC:28329	Inparanoid, OMA, EggNOG
Pig	397457	EDNRA	endothelin receptor type A	9823		Inparanoid, OMA, EggNOG
Opossum	100018535	EDNRA	endothelin receptor type A	13616		Inparanoid, OMA, EggNOG
Platypus	100079418	EDNRA	endothelin receptor type A	9258		Inparanoid, OMA, EggNOG
Chicken	373908	EDNRA	endothelin receptor type A	9031	CGNC:7610	Inparanoid, OMA, EggNOG
Anole lizard	100559070	ednra	endothelin receptor type A	28377		Inparanoid, OMA, EggNOG
Xenopus	779728	ednra	endothelin receptor type A	8364	XB-GENE-1006994	Inparanoid, OMA, EggNOG
Zebrafish	114550	ednraa	endothelin receptor type Aa	7955	ZDB-GENE-010906-2	Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]