JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Endothelin-1 receptor

Gene ID	1909
uniprot	P25101
Gene Name	EDNRA
Ensernbl ID	ENSP00000315011
Family	Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Sequence	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1909	EDNRA	Endothelin-1 receptor	P25101
MOUSE	13617	Ednra	Endothelin-1 receptor	Q61614
MOUSE		Ednra	Uncharacterized protein	Q8BMW4
RAT	24326	Ednra	Endothelin-1 receptor	P26684
RAT		Ednra	Endothelin receptor type A isoform L	A1Y2R7
RAT	24326	Ednra	Endothelin-1 receptor	A0A0G2JSX5
RAT	24326	Ednra	Endothelin receptor type A isoform C13	A1Y2B8
RAT		Ednra	Endothelin receptor type A isoform U3	A1Y2R8
RAT		Ednra	Endothelin receptor type A isoform U8	A1Y2R9

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx