Protein or Target Summary

Histone H2B type 1-K

Gene ID	85236
uniprot	O60814
Gene Name	HIST1H2BK
Ensernbl ID	ENSP00000349430
Family	Belongs to the histone H2B family.
Sequence	MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	85236	HIST1H2BK	Histone H2B type 1-K	O60814
MOUSE	319184	Hist1h2bk	Histone H2B type 1-K	Q8CGP1
MOUSE	319184	Hist1h2bk	Histone H2B	B2RVD5
RAT	680312	Hist1h2bk	Histone H2B	G3V9C7

PANTHER Classes
protein / nucleic acid binding / histone / Histone H2B type 1-K

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Histone / Histone H2B type 1-K

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source