The store will not work correctly when cookies are disabled.
GDNF
| Description | Glial cell line-derived neurotrophic factor |
|---|
Gene and Protein Information
| Gene ID | 2668 |
|---|
| Uniprot Accession IDs | B7WPK7 O95448 O95449 O95986 Q6FH33 Q96L44 Q9UD32 Q9UD33 Q9UMV2 Q9UP67 Q9UP97 hGDNF |
|---|
| Ensembl ID | ENSP00000409007 |
|---|
| Symbol | ATF ATF1 ATF2 HSCR3 HFB1-GDNF |
|---|
| Family | Belongs to the TGF-beta family. GDNF subfamily. |
|---|
| Sequence | MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471566 | GDNF | glial cell derived neurotrophic factor | 9598 | VGNC:14838 | OMA, EggNOG |
| Macaque | 706345 | GDNF | glial cell derived neurotrophic factor | 9544 | | Inparanoid, OMA |
| Mouse | 14573 | Gdnf | glial cell line derived neurotrophic factor | 10090 | MGI:107430 | Inparanoid, OMA, EggNOG |
| Rat | 25453 | Gdnf | glial cell derived neurotrophic factor | 10116 | RGD:2677 | Inparanoid, OMA, EggNOG |
| Dog | 489224 | GDNF | glial cell derived neurotrophic factor | 9615 | VGNC:41166 | Inparanoid, OMA, EggNOG |
| Horse | 100067053 | GDNF | glial cell derived neurotrophic factor | 9796 | VGNC:18295 | Inparanoid, OMA, EggNOG |
| Cow | 386587 | GDNF | glial cell derived neurotrophic factor | 9913 | VGNC:29309 | Inparanoid, OMA, EggNOG |
| Opossum | 100014283 | GDNF | glial cell derived neurotrophic factor | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | GDNF | glial cell derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:4232] | 9258 | | OMA, EggNOG |
| Chicken | 395569 | GDNF | glial cell derived neurotrophic factor | 9031 | CGNC:2717 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563031 | gdnf | glial cell derived neurotrophic factor | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100498061 | gdnf | glial cell derived neurotrophic factor | 8364 | XB-GENE-483795 | Inparanoid, OMA, EggNOG |
| Zebrafish | 79379 | gdnfa | glial cell derived neurotrophic factor a | 7955 | ZDB-GENE-010226-1 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
