The store will not work correctly when cookies are disabled.
EFNA2
Gene and Protein Information
| Gene ID | 1943 |
|---|
| Uniprot Accession IDs | O76020 |
|---|
| Ensembl ID | ENSP00000215368 |
|---|
| Symbol | EPLG6 LERK6 ELF-1 EPLG6 LERK6 HEK7-L LERK-6 |
|---|
| Family | Belongs to the ephrin family. |
|---|
| Sequence | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 749957 | EFNA2 | ephrin A2 | 9598 | VGNC:11002 | OMA, EggNOG |
| Mouse | 13637 | Efna2 | ephrin A2 | 10090 | MGI:102707 | Inparanoid, OMA, EggNOG |
| Rat | 84358 | Efna2 | ephrin A2 | 10116 | RGD:620389 | Inparanoid, OMA, EggNOG |
| Cow | 614453 | EFNA2 | ephrin A2 | 9913 | VGNC:28356 | Inparanoid, OMA, EggNOG |
| Opossum | 100021250 | EFNA2 | ephrin A2 | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100144647 | efna2 | ephrin A2 | 8364 | XB-GENE-488616 | Inparanoid, OMA, EggNOG |
| Zebrafish | | efna2b | ephrin-A2b | 7955 | ZDB-GENE-141120-2 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
