The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 1944 |
|---|
| Uniprot Accession IDs | B7ZAD3 D3DV85 Q0VGC9 Q5SR70 |
|---|
| Ensembl ID | ENSP00000357393 |
|---|
| Symbol | EFL2 EPLG3 LERK3 EFL2 EPLG3 LERK3 Ehk1-L |
|---|
| Family | Belongs to the ephrin family. |
|---|
| Sequence | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 740911 | EFNA3 | ephrin A3 | 9598 | VGNC:10610 | OMA, EggNOG |
| Macaque | 717373 | EFNA3 | ephrin A3 | 9544 | | Inparanoid, EggNOG |
| Mouse | 13638 | Efna3 | ephrin A3 | 10090 | MGI:106644 | Inparanoid, OMA, EggNOG |
| Rat | 170901 | Efna3 | ephrin A3 | 10116 | RGD:620390 | Inparanoid, OMA |
| Dog | 100856705 | EFNA3 | ephrin A3 | 9615 | | OMA, EggNOG |
| Horse | 100057186 | EFNA3 | ephrin A3 | 9796 | | OMA, EggNOG |
| Cow | 540776 | EFNA3 | ephrin A3 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100155923 | EFNA3 | ephrin A3 | 9823 | | OMA, EggNOG |
| Opossum | 100617157 | EFNA3 | ephrin A3 | 13616 | | OMA, EggNOG |
| Xenopus | 496827 | efna3 | ephrin A3 | 8364 | XB-GENE-5720826 | Inparanoid, EggNOG |
| Zebrafish | 100006460 | efna3a | ephrin-A3a | 7955 | ZDB-GENE-060503-186 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
