JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ephrin-A4

Gene ID	1945
uniprot	P52798
Gene Name	EFNA4
Ensernbl ID	ENSP00000414378
Family	Belongs to the ephrin family.
Sequence	MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1945	EFNA4	Ephrin-A4	P52798
MOUSE	13639	Efna4	Ephrin-A4	O08542
MOUSE	13639	Efna4	Uncharacterized protein	Q9CZS8
MOUSE	13639	Efna4	Ephrin A4	Q3UQB5
RAT	310643	Efna4	Ephrin A4	D3ZEN1
RAT		Efna4	Ephrin A4	A0A0G2K7C3

Protein Classes

PANTHER Classes
protein / signaling molecule / membrane-bound signaling molecule / Ephrin-A4

DTO Classes
protein / Signaling / Membrane-bound signaling molecule / Ephrin-A4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx