JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

G protein-activated inward rectifier potassium channel 3

Gene ID	3765
uniprot	Q92806
Gene Name	KCNJ9
Ensernbl ID	ENSP00000357067
Family	Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ9 subfamily.
Sequence	MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3765	KCNJ9	G protein-activated inward rectifier potassium channel 3	Q92806
MOUSE	16524	Kcnj9	G protein-gated K+ channel subunit 3 GIRK3	Q544N3
MOUSE	16524	Kcnj9	G protein-activated inward rectifier potassium channel 3	P48543
RAT		Kcnj9	G protein-activated inward rectifier potassium channel 3	A0A0G2JZD9
RAT	116560	Kcnj9	G protein-activated inward rectifier potassium channel 3	Q63511

Protein Classes

DTO Classes
protein / Ion channel / Inward rectifier-type potassium channel family / KCNJ9 subfamily / G protein-activated inward rectifier potassium channel 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx