JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
HCAR3

HCAR3

Description	Hydroxycarboxylic acid receptor 3

Gene and Protein Information

Gene ID	8843
Uniprot Accession IDs	A8K4G5 B2R830 E9PI97 Q8NGE4
Ensembl ID	ENSP00000436714
Symbol	GPR109B HCA3 HM74B NIACR2 HCA3 HM74 PUMAG Puma-g GPR109B
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	452411	HCAR3	hydroxycarboxylic acid receptor 3	9598	VGNC:13105	OMA, EggNOG
Mouse	80885	Hcar2	hydroxycarboxylic acid receptor 2	10090	MGI:1933383	Inparanoid, OMA, EggNOG
Rat	353250	Hcar2	hydroxycarboxylic acid receptor 2	10116	RGD:727952	Inparanoid, OMA, EggNOG
Opossum	100022273	LOC100022273	hydroxycarboxylic acid receptor 2	13616		Inparanoid, OMA

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Hydroxycarboxylic acid receptor / Hydroxycarboxylic acid receptor 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]