The store will not work correctly when cookies are disabled.
KLF10
| Description | Krueppel-like factor 10 |
|---|
Gene and Protein Information
| Gene ID | 7071 |
|---|
| Uniprot Accession IDs | A8MVH0 B2R794 L0R4P6 L0R679 O75411 Q503B2 |
|---|
| Ensembl ID | ENSP00000285407 |
|---|
| Symbol | TIEG TIEG1 EGRA TIEG TIEG1 EGR-alpha |
|---|
| Family | Belongs to the Sp1 C2H2-type zinc-finger protein family. |
|---|
| Sequence | MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472833 | KLF10 | Kruppel like factor 10 | 9598 | VGNC:13169 | OMA, EggNOG |
| Macaque | 693458 | KLF10 | Kruppel like factor 10 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 21847 | Klf10 | Kruppel-like factor 10 | 10090 | MGI:1101353 | Inparanoid, OMA, EggNOG |
| Rat | 81813 | Klf10 | Kruppel-like factor 10 | 10116 | RGD:621652 | Inparanoid, OMA, EggNOG |
| Dog | 481992 | KLF10 | Kruppel like factor 10 | 9615 | VGNC:42431 | Inparanoid, OMA, EggNOG |
| Horse | 100062273 | KLF10 | Kruppel like factor 10 | 9796 | VGNC:19440 | Inparanoid, OMA, EggNOG |
| Cow | 522795 | KLF10 | Kruppel like factor 10 | 9913 | VGNC:30627 | Inparanoid, OMA, EggNOG |
| Pig | 100153665 | KLF10 | Kruppel like factor 10 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100023770 | KLF10 | Kruppel like factor 10 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100090745 | KLF10 | Kruppel like factor 10 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566026 | klf10 | Kruppel like factor 10 | 28377 | | Inparanoid, OMA |
| Xenopus | 100490524 | klf10 | Kruppel-like factor 10 | 8364 | XB-GENE-854761 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
