Protein or Target Summary
Krueppel-like factor 10
| Gene ID | 7071 |
|---|---|
| uniprot | Q13118 |
| Gene Name | KLF10 |
| Ensernbl ID | ENSP00000285407 |
| Family | Belongs to the Sp1 C2H2-type zinc-finger protein family. |
| Sequence | MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 7071 | KLF10 | Krueppel-like factor 10 | Q13118 |
| MOUSE | Klf10 | Krueppel-like factor 10 | A0A2I3BPZ3 | |
| MOUSE | Klf10 | Krueppel-like factor 10 | A0A2I3BRQ2 | |
| MOUSE | Klf10 | Krueppel-like factor 10 | A0A2I3BQ59 | |
| MOUSE | Klf10 | GC Binding Protein - 23b | Q61596 | |
| MOUSE | Klf10 | Krueppel-like factor 10 | A0A2I3BRS7 | |
| MOUSE | Klf10 | Uncharacterized protein | Q3U3K0 | |
| MOUSE | 21847 | Klf10 | Krueppel-like factor 10 | Q8C900 |
| MOUSE | 21847 | Klf10 | Krueppel-like factor 10 | O89091 |
| RAT | Klf10 | Krueppel-like factor 10 | A0A0G2JX73 | |
| RAT | 81813 | Klf10 | Krueppel-like factor 10 | O08876 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Krueppel-like factor 10
protein / nucleic acid binding / transcription cofactor / Krueppel-like factor 10
protein / nucleic acid binding / zinc finger transcription factor / Krueppel-like factor 10
protein / nucleic acid binding / DNA binding protein / Krueppel-like factor 10
protein / nucleic acid binding / transcription cofactor / Krueppel-like factor 10
protein / nucleic acid binding / zinc finger transcription factor / Krueppel-like factor 10
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx