The store will not work correctly when cookies are disabled.
KLF2
Description | Krueppel-like factor 2 |
---|
Gene and Protein Information
Gene ID | 10365 |
Uniprot Accession IDs | Q6IPC4 Q9UJS5 Q9UKR6 |
Ensembl ID | ENSP00000248071 |
Symbol | LKLF LKLF |
Family | Belongs to the krueppel C2H2-type zinc-finger protein family. |
Sequence | MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 748298 | KLF2 | Kruppel like factor 2 | 9598 | VGNC:11146 | OMA, EggNOG |
Mouse | 16598 | Klf2 | Kruppel-like factor 2 (lung) | 10090 | MGI:1342772 | Inparanoid, OMA, EggNOG |
Rat | 306330 | Klf2 | Kruppel-like factor 2 | 10116 | RGD:1359220 | Inparanoid, OMA, EggNOG |
Opossum | 100014710 | KLF2 | Kruppel like factor 2 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 420148 | KLF2 | Kruppel like factor 2 | 9031 | CGNC:2890 | Inparanoid, OMA, EggNOG |
Xenopus | 549518 | klf2 | Kruppel-like factor 2 | 8364 | XB-GENE-485035 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|