JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

KLF2

Description	Krueppel-like factor 2

Gene and Protein Information

Gene ID	10365
Uniprot Accession IDs	Q6IPC4 Q9UJS5 Q9UKR6
Ensembl ID	ENSP00000248071
Symbol	LKLF LKLF
Family	Belongs to the krueppel C2H2-type zinc-finger protein family.
Sequence	MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748298	KLF2	Kruppel like factor 2	9598	VGNC:11146	OMA, EggNOG
Mouse	16598	Klf2	Kruppel-like factor 2 (lung)	10090	MGI:1342772	Inparanoid, OMA, EggNOG
Rat	306330	Klf2	Kruppel-like factor 2	10116	RGD:1359220	Inparanoid, OMA, EggNOG
Opossum	100014710	KLF2	Kruppel like factor 2	13616		Inparanoid, OMA, EggNOG
Chicken	420148	KLF2	Kruppel like factor 2	9031	CGNC:2890	Inparanoid, OMA, EggNOG
Xenopus	549518	klf2	Kruppel-like factor 2	8364	XB-GENE-485035	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Krueppel-like factor 2
protein    /    nucleic acid binding    /    transcription cofactor    /    Krueppel-like factor 2
protein    /    nucleic acid binding    /    zinc finger transcription factor    /    Krueppel-like factor 2

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Krueppel-like factor 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]