Protein or Target Summary

Krueppel-like factor 2

Gene ID	10365
uniprot	Q9Y5W3
Gene Name	KLF2
Ensernbl ID	ENSP00000248071
Family	Belongs to the krueppel C2H2-type zinc-finger protein family.
Sequence	MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10365	KLF2	Krueppel-like factor 2	Q9Y5W3
MOUSE	16598	Klf2	Uncharacterized protein	Q3V293
MOUSE	16598	Klf2	Krueppel-like factor 2	Q60843
RAT	306330	Klf2	Krueppel-like factor 2	Q9ET58

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Krueppel-like factor 2
protein    /    nucleic acid binding    /    transcription cofactor    /    Krueppel-like factor 2
protein    /    nucleic acid binding    /    zinc finger transcription factor    /    Krueppel-like factor 2

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Krueppel-like factor 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx