The store will not work correctly when cookies are disabled.
GSTA2
| Description | Glutathione S-transferase A2 |
|---|
Gene and Protein Information
| Gene ID | 2939 |
|---|
| Uniprot Accession IDs | Q12759 Q16491 Q9NTY6 |
|---|
| Ensembl ID | ENSP00000420168 |
|---|
| Symbol | GST2 GST2 GTA2 GTH2 GSTA2-2 |
|---|
| Family | Belongs to the GST superfamily. Alpha family. |
|---|
| Sequence | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
