The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase A2
| Gene ID | 2939 |
|---|
| uniprot | P09210 |
|---|
| Gene Name | GSTA2 |
|---|
| Ensernbl ID | ENSP00000420168 |
|---|
| Family | Belongs to the GST superfamily. Alpha family. |
|---|
| Sequence | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2939 | GSTA2 | Glutathione S-transferase A2 | P09210 |
| MOUSE | | Gsta2 | Glutathione S-transferase | D3YZV3 |
| MOUSE | | Gsta2 | Glutathione S-transferase | D3Z6A6 |
| MOUSE | 14858 | Gsta2 | Glutathione S-transferase A2 | P10648 |
| RAT | | Gsta2 | Glutathione S-transferase alpha-2 | F7F2H5 |
| RAT | 24422 | Gsta2 | Glutathione S-transferase alpha 2 | B6DYP7 |
| RAT | 494499 | Gsta2 | Glutathione S-transferase alpha-2 | P04903 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
