JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Histone H1.3

Gene ID	3007
uniprot	P16402
Gene Name	HIST1H1D
Ensernbl ID	ENSP00000244534
Family	Belongs to the histone H1/H5 family.
Sequence	MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3007	HIST1H1D	Histone H1.3	P16402
MOUSE		Hist1h1d	Uncharacterized protein	Q3U292
MOUSE	14957	Hist1h1d	Histone cluster 1, H1d	Q149Z9
MOUSE	14957	Hist1h1d	Histone H1.3	P43277
RAT	684828	Hist1h1d	Histone cluster 1 H1 family member d	M0R7B4

Protein Classes

PANTHER Classes
protein / nucleic acid binding / histone / Histone H1.3

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Histone / Histone H1.3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx