The store will not work correctly when cookies are disabled.
HIST1H1D
Gene and Protein Information
| Gene ID | 3007 |
|---|
| Uniprot Accession IDs | B2R751 Q2M2I2 |
|---|
| Ensembl ID | ENSP00000244534 |
|---|
| Symbol | H1F3 H1D H1.3 H1F3 H1s-2 |
|---|
| Family | Belongs to the histone H1/H5 family. |
|---|
| Sequence | MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472227 | HIST1H1D | histone cluster 1 H1 family member d | 9598 | VGNC:14368 | OMA, EggNOG |
| Macaque | 698238 | HIST1H1D | histone cluster 1, H1d | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14957 | Hist1h1d | histone cluster 1, H1d | 10090 | MGI:107502 | Inparanoid, EggNOG |
| Cow | 509275 | HIST1H1D | histone cluster 1, H1d | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
