JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
HIST1H1D

HIST1H1D

Description	Histone H1.3

Gene and Protein Information

Gene ID	3007
Uniprot Accession IDs	B2R751 Q2M2I2
Ensembl ID	ENSP00000244534
Symbol	H1F3 H1D H1.3 H1F3 H1s-2
Family	Belongs to the histone H1/H5 family.
Sequence	MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472227	HIST1H1D	histone cluster 1 H1 family member d	9598	VGNC:14368	OMA, EggNOG
Macaque	698238	HIST1H1D	histone cluster 1, H1d	9544		Inparanoid, OMA, EggNOG
Mouse	14957	Hist1h1d	histone cluster 1, H1d	10090	MGI:107502	Inparanoid, EggNOG
Cow	509275	HIST1H1D	histone cluster 1, H1d	9913		Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / nucleic acid binding / histone / Histone H1.3

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Histone / Histone H1.3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]