| Description | Rhodopsin kinase |
|---|
Gene and Protein Information
| Gene ID | 131890 |
|---|---|
| Uniprot Accession IDs | Q8WTQ7 |
| Ensembl ID | ENSP00000264952 |
| Symbol | GPRK7 GPRK7 |
| Family | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily. |
| Sequence | MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEKEILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQIACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPEILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFTEEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 714916 | GRK7 | G protein-coupled receptor kinase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Dog | 485693 | GRK7 | G protein-coupled receptor kinase 7 | 9615 | VGNC:41507 | Inparanoid, OMA, EggNOG |
| Horse | 100062922 | GRK7 | G protein-coupled receptor kinase 7 | 9796 | VGNC:18598 | Inparanoid, OMA, EggNOG |
| Cow | 281802 | GRK7 | G protein-coupled receptor kinase 7 | 9913 | VGNC:29658 | Inparanoid, OMA, EggNOG |
| Pig | 397114 | GRK7 | G protein-coupled receptor kinase 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100013800 | GRK7 | G protein-coupled receptor kinase 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 429125 | GRK7 | G protein-coupled receptor kinase 7 | 9031 | CGNC:2020 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557153 | grk7 | G protein-coupled receptor kinase 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145727 | grk7 | G protein-coupled receptor kinase 7 | 8364 | XB-GENE-976670 | Inparanoid, OMA, EggNOG |
| Zebrafish | 566120 | grk7a | G protein-coupled receptor kinase 7a | 7955 | ZDB-GENE-050824-1 | OMA, EggNOG |
| Zebrafish | 373871 | grk7b | G protein-coupled receptor kinase 7b | 7955 | ZDB-GENE-030904-3 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / G protein-coupled receptor kinase 7
protein / protein kinase / G protein-coupled receptor kinase 7
protein / transferase / G protein-coupled receptor kinase 7
protein / kinase / G protein-coupled receptor kinase 7
protein / non-receptor serine/threonine protein kinase / G protein-coupled receptor kinase 7
protein / protein kinase / G protein-coupled receptor kinase 7
protein / transferase / G protein-coupled receptor kinase 7
protein / kinase / G protein-coupled receptor kinase 7
DTO Classes
protein / Kinase / Protein kinase / AGC group / GRK family / GRK subfamily / G protein-coupled receptor kinase 7
protein / Kinase / Protein kinase / AGC group / GRK family / GRK subfamily / G protein-coupled receptor kinase 7
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|